![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) ![]() common fold is elaborated with additional secondary structures |
![]() | Family d.58.29.0: automated matches [191671] (1 protein) not a true family |
![]() | Protein automated matches [191274] (13 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [311195] (1 PDB entry) |
![]() | Domain d1ybuc_: 1ybu C: [303398] automated match to d4wp9b_ complexed with apc, mn |
PDB Entry: 1ybu (more details), 2.4 Å
SCOPe Domain Sequences for d1ybuc_:
Sequence, based on SEQRES records: (download)
>d1ybuc_ d.58.29.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} aermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfggrevntagdgfva tftspsaaiacaddivdavaalgievrigihagevevrdashgtdvagvavhigarvcal agpsevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrd
>d1ybuc_ d.58.29.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} aermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfggrevntagdgfva tftspsaaiacaddivdavaalgievrigihagevevrdatdvagvavhigarvcalagp sevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrd
Timeline for d1ybuc_: