Lineage for d1ybub_ (1ybu B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954779Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954860Family d.58.29.0: automated matches [191671] (1 protein)
    not a true family
  6. 2954861Protein automated matches [191274] (13 species)
    not a true protein
  7. 2954926Species Mycobacterium tuberculosis [TaxId:83332] [311195] (1 PDB entry)
  8. 2954928Domain d1ybub_: 1ybu B: [303397]
    automated match to d4wp9b_
    complexed with apc, mn

Details for d1ybub_

PDB Entry: 1ybu (more details), 2.4 Å

PDB Description: mycobacterium tuberculosis adenylyl cyclase rv1900c chd, in complex with a substrate analog.
PDB Compounds: (B:) lipJ

SCOPe Domain Sequences for d1ybub_:

Sequence, based on SEQRES records: (download)

>d1ybub_ d.58.29.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
aermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfggrevntagdgfva
tftspsaaiacaddivdavaalgievrigihagevevrdashgtdvagvavhigarvcal
agpsevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrd

Sequence, based on observed residues (ATOM records): (download)

>d1ybub_ d.58.29.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
aermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfggrevntagdgfva
tftspsaaiacaddivdavaalgievrigihagevevrdatdvagvavhigarvcalagp
sevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrd

SCOPe Domain Coordinates for d1ybub_:

Click to download the PDB-style file with coordinates for d1ybub_.
(The format of our PDB-style files is described here.)

Timeline for d1ybub_: