| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) ![]() common fold is elaborated with additional secondary structures |
| Family d.58.29.0: automated matches [191671] (1 protein) not a true family |
| Protein automated matches [191274] (13 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:83332] [311195] (1 PDB entry) |
| Domain d1ybua_: 1ybu A: [303396] automated match to d4wp9b_ complexed with apc, mn |
PDB Entry: 1ybu (more details), 2.4 Å
SCOPe Domain Sequences for d1ybua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ybua_ d.58.29.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
aermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfggrevntagdgfva
tftspsaaiacaddivdavaalgievrigihagevevrdashgtdvagvavhigarvcal
agpsevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrd
Timeline for d1ybua_: