Lineage for d1ybtc_ (1ybt C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954779Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954860Family d.58.29.0: automated matches [191671] (1 protein)
    not a true family
  6. 2954861Protein automated matches [191274] (13 species)
    not a true protein
  7. 2954921Species Mycobacterium tuberculosis [TaxId:83331] [311197] (1 PDB entry)
  8. 2954924Domain d1ybtc_: 1ybt C: [303394]
    automated match to d4wp9b_

Details for d1ybtc_

PDB Entry: 1ybt (more details), 2.31 Å

PDB Description: mycobacterium tuberculosis adenylyl cyclase, rv1900c chd
PDB Compounds: (C:) hydrolase, alpha/beta hydrolase fold family

SCOPe Domain Sequences for d1ybtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ybtc_ d.58.29.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
aermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfggrevntagdgfva
tftspsaaiacaddivdavaalgievrigihagevevrdashgtdvagvavhigarvcal
agpsevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrddatrtr

SCOPe Domain Coordinates for d1ybtc_:

Click to download the PDB-style file with coordinates for d1ybtc_.
(The format of our PDB-style files is described here.)

Timeline for d1ybtc_: