Lineage for d1ybtb_ (1ybt B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. Family d.58.29.0: automated matches [191671] (1 protein)
    not a true family
  6. Protein automated matches [191274] (13 species)
    not a true protein
  7. Species Mycobacterium tuberculosis [TaxId:83331] [311197] (1 PDB entry)
  8. Domain d1ybtb_: 1ybt B: [303393]
    automated match to d4wp9b_

Details for d1ybtb_

PDB Entry: 1ybt (more details), 2.31 Å

PDB Description: mycobacterium tuberculosis adenylyl cyclase, rv1900c chd
PDB Compounds: (B:) hydrolase, alpha/beta hydrolase fold family

SCOPe Domain Sequences for d1ybtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ybtb_ d.58.29.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
aermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfggrevntagdgfva
tftspsaaiacaddivdavaalgievrigihagevevrdashgtdvagvavhigarvcal
agpsevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrddatrtr

SCOPe Domain Coordinates for d1ybtb_ are not available.

Timeline for d1ybtb_:

Domains from other chains:
(mouse over for more information)
d1ybta_, d1ybtc_, d1ybtd_