Lineage for d1ybbd_ (1ybb D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613889Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 2614110Superfamily d.230.5: YbjQ-like [117782] (2 families) (S)
    pentamer, beta/alpha-propeller; additional short beta-strands promote oligomeric assembly
  5. 2614111Family d.230.5.1: YbjQ-like [117783] (3 proteins)
    Pfam PF01906; DUF 74, UPF0145
  6. 2614112Protein Hypothetical protein BC1012 [142892] (1 species)
  7. 2614113Species Bacillus cereus [TaxId:1396] [142893] (2 PDB entries)
    Uniprot Q81H14 1-103
  8. 2614116Domain d1ybbd_: 1ybb D: [303390]
    automated match to d1vr4a1

Details for d1ybbd_

PDB Entry: 1ybb (more details), 2.09 Å

PDB Description: Crystal Structure of MCSG TArget APC22750 from Bacillus cereus
PDB Compounds: (D:) hypothetical protein APC22750

SCOPe Domain Sequences for d1ybbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ybbd_ d.230.5.1 (D:) Hypothetical protein BC1012 {Bacillus cereus [TaxId: 1396]}
mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardi
amdemkelakqkganaivgvdvdyevvrdgmlmvavsgtavri

SCOPe Domain Coordinates for d1ybbd_:

Click to download the PDB-style file with coordinates for d1ybbd_.
(The format of our PDB-style files is described here.)

Timeline for d1ybbd_: