Lineage for d1ybbc_ (1ybb C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2240281Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 2240477Superfamily d.230.5: YbjQ-like [117782] (2 families) (S)
    pentamer, beta/alpha-propeller; additional short beta-strands promote oligomeric assembly
  5. 2240478Family d.230.5.1: YbjQ-like [117783] (3 proteins)
    Pfam PF01906; DUF 74, UPF0145
  6. 2240479Protein Hypothetical protein BC1012 [142892] (1 species)
  7. 2240480Species Bacillus cereus [TaxId:1396] [142893] (2 PDB entries)
    Uniprot Q81H14 1-103
  8. 2240482Domain d1ybbc_: 1ybb C: [303389]
    automated match to d1vr4a1

Details for d1ybbc_

PDB Entry: 1ybb (more details), 2.09 Å

PDB Description: Crystal Structure of MCSG TArget APC22750 from Bacillus cereus
PDB Compounds: (C:) hypothetical protein APC22750

SCOPe Domain Sequences for d1ybbc_:

Sequence, based on SEQRES records: (download)

>d1ybbc_ d.230.5.1 (C:) Hypothetical protein BC1012 {Bacillus cereus [TaxId: 1396]}
mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardi
amdemkelakqkganaivgvdvdyevvrdgmlmvavsgtavri

Sequence, based on observed residues (ATOM records): (download)

>d1ybbc_ d.230.5.1 (C:) Hypothetical protein BC1012 {Bacillus cereus [TaxId: 1396]}
mivtttsgiqgkeiieyidivngeaimganivrdlfasvggragsyesklkeardiamde
mkelakqkganaivgvdvdyevvrdgmlmvavsgtavri

SCOPe Domain Coordinates for d1ybbc_:

Click to download the PDB-style file with coordinates for d1ybbc_.
(The format of our PDB-style files is described here.)

Timeline for d1ybbc_: