![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.230: Dodecin subunit-like [88797] (6 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
![]() | Superfamily d.230.5: YbjQ-like [117782] (2 families) ![]() pentamer, beta/alpha-propeller; additional short beta-strands promote oligomeric assembly |
![]() | Family d.230.5.1: YbjQ-like [117783] (3 proteins) Pfam PF01906; DUF 74, UPF0145 |
![]() | Protein Hypothetical protein BC1012 [142892] (1 species) |
![]() | Species Bacillus cereus [TaxId:1396] [142893] (2 PDB entries) Uniprot Q81H14 1-103 |
![]() | Domain d1ybba_: 1ybb A: [303388] automated match to d1vr4a1 |
PDB Entry: 1ybb (more details), 2.09 Å
SCOPe Domain Sequences for d1ybba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ybba_ d.230.5.1 (A:) Hypothetical protein BC1012 {Bacillus cereus [TaxId: 1396]} mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardi amdemkelakqkganaivgvdvdyevvrdgmlmvavsgtavri
Timeline for d1ybba_: