Lineage for d1yawb2 (1yaw B:138-300)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978140Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2978141Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2978142Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins)
  6. 2978217Protein automated matches [310848] (1 species)
    not a true protein
  7. 2978218Species Aquifex aeolicus [311196] (1 PDB entry)
  8. 2978220Domain d1yawb2: 1yaw B:138-300 [303387]
    Other proteins in same PDB: d1yawa1, d1yawb1
    automated match to d3c9ua2
    complexed with po4

Details for d1yawb2

PDB Entry: 1yaw (more details), 2.65 Å

PDB Description: Crystal structure of thiamine monophosphate kinase (thiL) from Aquifex aeolicus
PDB Compounds: (B:) Thiamine monophosphate kinase

SCOPe Domain Sequences for d1yawb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yawb2 d.139.1.1 (B:138-300) automated matches {Aquifex aeolicus}
rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyeefelaliqrhlrptaridyvkh
iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf
ggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep

SCOPe Domain Coordinates for d1yawb2:

Click to download the PDB-style file with coordinates for d1yawb2.
(The format of our PDB-style files is described here.)

Timeline for d1yawb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yawb1