Lineage for d1yawb1 (1yaw B:1-137)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)
  6. Protein automated matches [227043] (2 species)
    not a true protein
  7. Species Aquifex aeolicus [311194] (1 PDB entry)
  8. Domain d1yawb1: 1yaw B:1-137 [303386]
    Other proteins in same PDB: d1yawa2, d1yawb2
    automated match to d3c9ua1
    complexed with po4

Details for d1yawb1

PDB Entry: 1yaw (more details), 2.65 Å

PDB Description: Crystal structure of thiamine monophosphate kinase (thiL) from Aquifex aeolicus
PDB Compounds: (B:) Thiamine monophosphate kinase

SCOPe Domain Sequences for d1yawb1:

Sequence, based on SEQRES records: (download)

>d1yawb1 d.79.4.1 (B:1-137) automated matches {Aquifex aeolicus}
mrlkelaefglidlikktleskvigddtapveycskklllttdvlnegvhflrsyipeav
gwkaisvnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggni
sksekigisvflvgete

Sequence, based on observed residues (ATOM records): (download)

>d1yawb1 d.79.4.1 (B:1-137) automated matches {Aquifex aeolicus}
mrlkelaefglidlikktleskviddtapveklllttdvlnegvhflrsyipeavgwkai
svnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggnisksek
igisvflvgete

SCOPe Domain Coordinates for d1yawb1 are not available.

Timeline for d1yawb1:

Domains from same chain:
(mouse over for more information)
d1yawb2
Domains from other chains:
(mouse over for more information)
d1yawa1, d1yawa2