Lineage for d1yawa2 (1yaw A:138-300)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins)
  6. Protein automated matches [310848] (1 species)
    not a true protein
  7. Species Aquifex aeolicus [311196] (1 PDB entry)
  8. Domain d1yawa2: 1yaw A:138-300 [303385]
    Other proteins in same PDB: d1yawa1, d1yawb1
    automated match to d3c9ua2
    complexed with po4

Details for d1yawa2

PDB Entry: 1yaw (more details), 2.65 Å

PDB Description: Crystal structure of thiamine monophosphate kinase (thiL) from Aquifex aeolicus
PDB Compounds: (A:) Thiamine monophosphate kinase

SCOPe Domain Sequences for d1yawa2:

Sequence, based on SEQRES records: (download)

>d1yawa2 d.139.1.1 (A:138-300) automated matches {Aquifex aeolicus}
rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyeefelaliqrhlrptaridyvkh
iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf
ggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep

Sequence, based on observed residues (ATOM records): (download)

>d1yawa2 d.139.1.1 (A:138-300) automated matches {Aquifex aeolicus}
rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyeefelaliqrhlrptaridyvkh
iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf
ggedyqllfthpkerwnpfldmteigrveeggvfvdgkkvep

SCOPe Domain Coordinates for d1yawa2 are not available.

Timeline for d1yawa2:

Domains from same chain:
(mouse over for more information)
d1yawa1
Domains from other chains:
(mouse over for more information)
d1yawb1, d1yawb2