Lineage for d1pbea1 (1pbe A:1-173,A:276-391)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 822279Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 822280Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 822334Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 822505Protein p-Hydroxybenzoate hydroxylase, PHBH [51917] (2 species)
  7. 822526Species Pseudomonas fluorescens [TaxId:294] [51918] (17 PDB entries)
  8. 822529Domain d1pbea1: 1pbe A:1-173,A:276-391 [30338]
    Other proteins in same PDB: d1pbea2
    complexed with fad, phb

Details for d1pbea1

PDB Entry: 1pbe (more details), 1.9 Å

PDB Description: crystal structure of the p-hydroxybenzoate hydroxylase-substrate complex refined at 1.9 angstroms resolution. analysis of the enzyme- substrate and enzyme-product complexes
PDB Compounds: (A:) p-hydroxybenzoate hydroxylase

SCOP Domain Sequences for d1pbea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbea1 c.3.1.2 (A:1-173,A:276-391) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas fluorescens [TaxId: 294]}
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrl
flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer
fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpye

SCOP Domain Coordinates for d1pbea1:

Click to download the PDB-style file with coordinates for d1pbea1.
(The format of our PDB-style files is described here.)

Timeline for d1pbea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pbea2