Lineage for d1xv1a_ (1xv1 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. Protein Thyroid hormone sulfotransferase Sult1b1 [117530] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [117531] (2 PDB entries)
    Uniprot O43704
  8. Domain d1xv1a_: 1xv1 A: [303373]
    automated match to d3cklb_
    complexed with a3p

Details for d1xv1a_

PDB Entry: 1xv1 (more details), 2.1 Å

PDB Description: Human sulfotransferase SULT1B1 in complex with PAP
PDB Compounds: (A:) sulfotransferase

SCOPe Domain Sequences for d1xv1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xv1a_ c.37.1.5 (A:) Thyroid hormone sulfotransferase Sult1b1 {Human (Homo sapiens) [TaxId: 9606]}
pkdilrkdlklvhgypmtcafasnwekieqfhsrpddiviatypksgttwvseiidmiln
dgdiekckrgfitekvpmlemtlpglrtsgieqleknpsprivkthlptdllpksfwenn
ckmiylarnakdvsvsyyhfdlmnnlqpfpgtweeylekfltgkvaygswfthvknwwkk
keehpilflyyedmkenpkeeikkiirfleknlndeildriihhtsfevmkdnplvnyth
lpttvmdhskspfmrkgtagdwknyftvaqnekfdaiyetemsktalqfrtei

SCOPe Domain Coordinates for d1xv1a_ are not available.

Timeline for d1xv1a_:

Domains from other chains:
(mouse over for more information)
d1xv1b_