Lineage for d1xp2c1 (1xp2 C:2-149)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956780Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2956781Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) (S)
    zinc-binding motif
  5. 2956851Family d.65.1.5: VanY-like [160436] (2 proteins)
    Pfam PF02557
  6. 2956852Protein L-alanyl-D-glutamate peptidase Ply [160437] (1 species)
  7. 2956853Species Listeria phage A500 [TaxId:40522] [160438] (2 PDB entries)
    Uniprot Q37979 1-148
  8. 2956855Domain d1xp2c1: 1xp2 C:2-149 [303369]
    Other proteins in same PDB: d1xp2b2, d1xp2c2
    automated match to d2vo9a1
    complexed with na, so4, zn

Details for d1xp2c1

PDB Entry: 1xp2 (more details), 1.8 Å

PDB Description: Crystal structure of the enzymatically active domain of the listeria monocytogenes bacteriophage 500 endolysin Ply500
PDB Compounds: (C:) l-alanyl-d-glutamate peptidase

SCOPe Domain Sequences for d1xp2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xp2c1 d.65.1.5 (C:2-149) L-alanyl-D-glutamate peptidase Ply {Listeria phage A500 [TaxId: 40522]}
malteawliekanrklnaggmykitsdktrnvikkmakegiylcvaqgyrstaeqnalya
qgrtkpgaivtnakggqsnhnygvavdlclytndgkdviwesttsrwkkvvaamkaegfk
wggdwksfkdyphfelcdavsgekipaa

SCOPe Domain Coordinates for d1xp2c1:

Click to download the PDB-style file with coordinates for d1xp2c1.
(The format of our PDB-style files is described here.)

Timeline for d1xp2c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xp2c2