SCOPe 2.08: Domain d1xp2b1: 1xp2 B:2-149

Lineage for d1xp2b1 (1xp2 B:2-149)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families)
   zinc-binding motif

5. Family d.65.1.5: VanY-like [160436] (2 proteins)
   Pfam PF02557

6. Protein L-alanyl-D-glutamate peptidase Ply [160437] (1 species)

7. Species Listeria phage A500 [TaxId:40522] [160438] (2 PDB entries)
   Uniprot Q37979 1-148

8. Domain d1xp2b1: 1xp2 B:2-149 [303367]
   Other proteins in same PDB: d1xp2b2, d1xp2c2
   automated match to d2vo9a1
   complexed with na, so4, zn

Details for d1xp2b1

PDB Entry: 1xp2, 1.8 Å

PDB Description: Crystal structure of the enzymatically active domain of the listeria monocytogenes bacteriophage 500 endolysin Ply500

PDB Compounds: (B:) l-alanyl-d-glutamate peptidase

SCOPe Domain Sequences for d1xp2b1:

Sequence; same for both SEQRES and ATOM records:

>d1xp2b1 d.65.1.5 (B:2-149) L-alanyl-D-glutamate peptidase Ply {Listeria phage A500 [TaxId: 40522]}
malteawliekanrklnaggmykitsdktrnvikkmakegiylcvaqgyrstaeqnalya
qgrtkpgaivtnakggqsnhnygvavdlclytndgkdviwesttsrwkkvvaamkaegfk
wggdwksfkdyphfelcdavsgekipaa

Timeline for d1xp2b1:

• d1xp2b1 first appeared in SCOPe 2.06
  
• d1xp2b1 appears in SCOPe 2.07