SCOPe 2.07: Domain d1xnpb_: 1xnp B:

Lineage for d1xnpb_ (1xnp B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.64: PF1790-like [140286] (1 protein)
   sequence similarity to PH1932 in the N-terminal domain; the C-terminal domain provides new dimerisation interface made of a beta-hairpin and a coiled coil

6. Protein Transcriptional regulatory protein PF1790 [140287] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [140288] (2 PDB entries)
   Uniprot Q8U030 1-194

8. Domain d1xnpb_: 1xnp B: [303365]
   automated match to d2p4wb_
   complexed with edo, so4

Details for d1xnpb_

PDB Entry: 1xnp, 2.8 Å

PDB Description: Crystal Structure of a novel heat shock regulator from Pyrococcus furiosus

PDB Compounds: (B:) Transcriptional regulatory protein arsR family

SCOPe Domain Sequences for d1xnpb_:

Sequence; same for both SEQRES and ATOM records:

>d1xnpb_ a.4.5.64 (B:) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]}
mgeelnrlldvlgnetrrrilflltkrpyfvselsrelgvgqkavlehlrileeaglies
rvekiprgrprkyymikkglrleilltptlfgsemyeakgvrkspeyeqakeliksqepi
nvkmrelaeflhelnerireiieekreleearilietyientmrrlaeenrqiieeifrd
iekilppgyarslkekfln

Timeline for d1xnpb_:

• d1xnpb_ first appeared in SCOPe 2.06
  
• d1xnpb_ appears in the current release, SCOPe 2.08