![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.64: PF1790-like [140286] (1 protein) sequence similarity to PH1932 in the N-terminal domain; the C-terminal domain provides new dimerisation interface made of a beta-hairpin and a coiled coil |
![]() | Protein Transcriptional regulatory protein PF1790 [140287] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [140288] (2 PDB entries) Uniprot Q8U030 1-194 |
![]() | Domain d1xnpa_: 1xnp A: [303364] automated match to d2p4wb_ complexed with edo, so4 |
PDB Entry: 1xnp (more details), 2.8 Å
SCOPe Domain Sequences for d1xnpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnpa_ a.4.5.64 (A:) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} mgeelnrlldvlgnetrrrilflltkrpyfvselsrelgvgqkavlehlrileeaglies rvekiprgrprkyymikkglrleilltptlfgsemyeakgvrkspeyeqakeliksqepi nvkmrelaeflhelnerireiieekreleearilietyientmrrlaeenrqiieeifrd iekilppgyarslk
Timeline for d1xnpa_: