Lineage for d1xmrd3 (1xmr D:11-149)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins)
    N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684)
  6. Protein Thymidine kinase, TK1, N-terminal domain [117559] (4 species)
  7. Species Ureaplasma urealyticum [TaxId:2130] [117561] (3 PDB entries)
    Uniprot Q9PPP5 11-211
  8. Domain d1xmrd3: 1xmr D:11-149 [303362]
    Other proteins in same PDB: d1xmra4, d1xmrb4, d1xmrc4, d1xmrd4
    automated match to d2uz3a1
    complexed with mg, ttp, zn

Details for d1xmrd3

PDB Entry: 1xmr (more details), 2.5 Å

PDB Description: Crystal Structure of Thymidine Kinase with dTTP from U. urealyticum
PDB Compounds: (D:) Thymidine kinase

SCOPe Domain Sequences for d1xmrd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmrd3 c.37.1.24 (D:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}
igwiefitgpmfagktaelirrlhrleyadvkylvfkpkidtrsirniqsrtgtslpsve
vesapeilnyimsnsfndetkvigidevqffddricevanilaengfvviisgldknfkg
epfgpiaklftyadkitkl

SCOPe Domain Coordinates for d1xmrd3 are not available.

Timeline for d1xmrd3:

Domains from same chain:
(mouse over for more information)
d1xmrd4
Domains from other chains:
(mouse over for more information)
d1xmra3, d1xmra4, d1xmrb3, d1xmrb4, d1xmrc3, d1xmrc4