SCOPe 2.08: Domain d1xmrd3: 1xmr D:11-149

Lineage for d1xmrd3 (1xmr D:11-149)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins)
   N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684)

6. Protein Thymidine kinase, TK1, N-terminal domain [117559] (4 species)

7. Species Ureaplasma urealyticum [TaxId:2130] [117561] (3 PDB entries)
   Uniprot Q9PPP5 11-211

8. Domain d1xmrd3: 1xmr D:11-149 [303362]
   Other proteins in same PDB: d1xmra4, d1xmrb4, d1xmrc4, d1xmrd4
   automated match to d2uz3a1
   complexed with mg, ttp, zn

Details for d1xmrd3

PDB Entry: 1xmr, 2.5 Å

PDB Description: Crystal Structure of Thymidine Kinase with dTTP from U. urealyticum

PDB Compounds: (D:) Thymidine kinase

SCOPe Domain Sequences for d1xmrd3:

Sequence; same for both SEQRES and ATOM records:

>d1xmrd3 c.37.1.24 (D:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}
igwiefitgpmfagktaelirrlhrleyadvkylvfkpkidtrsirniqsrtgtslpsve
vesapeilnyimsnsfndetkvigidevqffddricevanilaengfvviisgldknfkg
epfgpiaklftyadkitkl

Timeline for d1xmrd3:

• d1xmrd3 first appeared in SCOPe 2.06
  
• d1xmrd3 appears in SCOPe 2.07