Lineage for d1cboa1 (1cbo A:9-318,A:451-506)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096508Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 protein domains)
    C-terminal domain is alpha+beta is common for the family
  6. 2096509Protein Cholesterol oxidase of GMC family [51914] (3 species)
  7. 2096515Species Streptomyces sp. [TaxId:1931] [51916] (14 PDB entries)
  8. 2096528Domain d1cboa1: 1cbo A:9-318,A:451-506 [30336]
    Other proteins in same PDB: d1cboa2
    complexed with fad; mutant

Details for d1cboa1

PDB Entry: 1cbo (more details), 1.8 Å

PDB Description: cholesterol oxidase from streptomyces his447asn mutant
PDB Compounds: (A:) protein (cholesterol oxidase)

SCOPe Domain Sequences for d1cboa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cboa1 c.3.1.2 (A:9-318,A:451-506) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]}
gyvpavvigtgygaavsalrlgeagvqtlmlemgqlwnqpgpdgnifcgmlnpdkrsswf
knrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgvgggslvnggmavepkr
syfeeilprvdssemydryfpransmlrvnhidtkwfedtewykfarvsreqagkaglgt
vfvpnvydfgymqreaagevpksalateviygnnhgkqsldktylaaalgtgkvtiqtlh
qvktirqtkdggyaltveqkdtdgkllatkeiscrylflgagslgstellvrardtgtlp
nlnsevgagwXgcvlgkatddygrvagyknlyvtdgslipgsvgvnpfvtitalaernve
riikqdv

SCOPe Domain Coordinates for d1cboa1:

Click to download the PDB-style file with coordinates for d1cboa1.
(The format of our PDB-style files is described here.)

Timeline for d1cboa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cboa2