Lineage for d1xmrb4 (1xmr B:150-217)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. Family g.39.1.14: Type II thymidine kinase zinc finger [118276] (1 protein)
    C-terminal part of Pfam PF00265
  6. Protein Thymidine kinase, TK1, C-terminal domain [118277] (4 species)
  7. Species Ureaplasma urealyticum [TaxId:2130] [118279] (3 PDB entries)
    Uniprot Q9PPP5 11-211
  8. Domain d1xmrb4: 1xmr B:150-217 [303359]
    Other proteins in same PDB: d1xmra3, d1xmrb3, d1xmrc3, d1xmrd3
    automated match to d2uz3a2
    complexed with mg, ttp, zn

Details for d1xmrb4

PDB Entry: 1xmr (more details), 2.5 Å

PDB Description: Crystal Structure of Thymidine Kinase with dTTP from U. urealyticum
PDB Compounds: (B:) Thymidine kinase

SCOPe Domain Sequences for d1xmrb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmrb4 g.39.1.14 (B:150-217) Thymidine kinase, TK1, C-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}
taicnecgaeathslrkidgkhadynddivkigcqefysavcrhhhkvpnrpylnsnsee
fikffknk

SCOPe Domain Coordinates for d1xmrb4 are not available.

Timeline for d1xmrb4:

Domains from same chain:
(mouse over for more information)
d1xmrb3
Domains from other chains:
(mouse over for more information)
d1xmra3, d1xmra4, d1xmrc3, d1xmrc4, d1xmrd3, d1xmrd4