Lineage for d1xmra4 (1xmr A:150-217)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3036088Family g.39.1.14: Type II thymidine kinase zinc finger [118276] (1 protein)
    C-terminal part of Pfam PF00265
  6. 3036089Protein Thymidine kinase, TK1, C-terminal domain [118277] (4 species)
  7. 3036106Species Ureaplasma urealyticum [TaxId:2130] [118279] (3 PDB entries)
    Uniprot Q9PPP5 11-211
  8. 3036111Domain d1xmra4: 1xmr A:150-217 [303357]
    Other proteins in same PDB: d1xmra3, d1xmrb3, d1xmrc3, d1xmrd3
    automated match to d2uz3a2
    complexed with mg, ttp, zn

    has additional insertions and/or extensions that are not grouped together

Details for d1xmra4

PDB Entry: 1xmr (more details), 2.5 Å

PDB Description: Crystal Structure of Thymidine Kinase with dTTP from U. urealyticum
PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d1xmra4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmra4 g.39.1.14 (A:150-217) Thymidine kinase, TK1, C-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}
taicnecgaeathslrkidgkhadynddivkigcqefysavcrhhhkvpnrpylnsnsee
fikffknk

SCOPe Domain Coordinates for d1xmra4:

Click to download the PDB-style file with coordinates for d1xmra4.
(The format of our PDB-style files is described here.)

Timeline for d1xmra4: