| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.63: CYTH-like phosphatases [55153] (1 superfamily) duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it |
Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) ![]() |
| Family d.63.1.2: CYTH domain [118007] (5 proteins) Pfam PF01928 |
| Protein Hypothetical protein PF0863 [118008] (1 species) |
| Species Pyrococcus furiosus [TaxId:2261] [118009] (2 PDB entries) Uniprot Q8U2H2 2-171 |
| Domain d1xkcb1: 1xkc B:2-166 [303351] Other proteins in same PDB: d1xkca2, d1xkcb2 automated match to d1yemb_ complexed with pt, unx |
PDB Entry: 1xkc (more details), 2.3 Å
SCOPe Domain Sequences for d1xkcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xkcb1 d.63.1.2 (B:2-166) Hypothetical protein PF0863 {Pyrococcus furiosus [TaxId: 2261]}
eveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnlkkyyltfke
ildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtlevnrvegig
dfvdievisdspeeakekiwevakmlglkeedveprlylelinel
Timeline for d1xkcb1: