Lineage for d1xkca1 (1xkc A:2-163)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563399Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
    duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it
  4. 2563400Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) (S)
  5. 2563414Family d.63.1.2: CYTH domain [118007] (5 proteins)
    Pfam PF01928
  6. 2563419Protein Hypothetical protein PF0863 [118008] (1 species)
  7. 2563420Species Pyrococcus furiosus [TaxId:2261] [118009] (2 PDB entries)
    Uniprot Q8U2H2 2-171
  8. 2563421Domain d1xkca1: 1xkc A:2-163 [303349]
    Other proteins in same PDB: d1xkca2, d1xkcb2
    automated match to d1yema_
    complexed with pt, unx

Details for d1xkca1

PDB Entry: 1xkc (more details), 2.3 Å

PDB Description: Conserved hypothetical protein Pfu-838710-001 from Pyrococcus furiosus
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1xkca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xkca1 d.63.1.2 (A:2-163) Hypothetical protein PF0863 {Pyrococcus furiosus [TaxId: 2261]}
eveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnlkkyyltfke
ildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtlevnrvegig
dfvdievisdspeeakekiwevakmlglkeedveprlyleli

SCOPe Domain Coordinates for d1xkca1:

Click to download the PDB-style file with coordinates for d1xkca1.
(The format of our PDB-style files is described here.)

Timeline for d1xkca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xkca2