SCOPe 2.08: Domain d1xkca1: 1xkc A:2-163

Lineage for d1xkca1 (1xkc A:2-163)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
   duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it

4. Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families)

5. Family d.63.1.2: CYTH domain [118007] (5 proteins)
   Pfam PF01928

6. Protein Hypothetical protein PF0863 [118008] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [118009] (2 PDB entries)
   Uniprot Q8U2H2 2-171

8. Domain d1xkca1: 1xkc A:2-163 [303349]
   Other proteins in same PDB: d1xkca2, d1xkcb2
   automated match to d1yema_
   complexed with pt, unx

Details for d1xkca1

PDB Entry: 1xkc, 2.3 Å

PDB Description: Conserved hypothetical protein Pfu-838710-001 from Pyrococcus furiosus

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1xkca1:

Sequence; same for both SEQRES and ATOM records:

>d1xkca1 d.63.1.2 (A:2-163) Hypothetical protein PF0863 {Pyrococcus furiosus [TaxId: 2261]}
eveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnlkkyyltfke
ildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtlevnrvegig
dfvdievisdspeeakekiwevakmlglkeedveprlyleli

Timeline for d1xkca1:

• d1xkca1 first appeared in SCOPe 2.06
  
• d1xkca1 appears in SCOPe 2.07