Lineage for d1xg9a3 (1xg9 A:1-164)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468682Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2468683Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2468684Family c.65.1.1: Formyltransferase [53329] (5 proteins)
  6. 2468756Protein Methionyl-tRNAfmet formyltransferase [53332] (2 species)
  7. 2468757Species Clostridium thermocellum [TaxId:1515] [117677] (2 PDB entries)
    Uniprot Q4HJX2 47% sequence identity
    Structural genomics target; GI:67850689
  8. 2468758Domain d1xg9a3: 1xg9 A:1-164 [303346]
    Other proteins in same PDB: d1xg9a4, d1xg9a5
    automated match to d1zgha2
    complexed with cl

Details for d1xg9a3

PDB Entry: 1xg9 (more details), 2.05 Å

PDB Description: Methionyl-tRNA formyltransferase from Clostridium thermocellum
PDB Compounds: (A:) Methionyl-tRNA formyltransferase

SCOPe Domain Sequences for d1xg9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xg9a3 c.65.1.1 (A:1-164) Methionyl-tRNAfmet formyltransferase {Clostridium thermocellum [TaxId: 1515]}
mniiiattkswniknaqkfkkeneskynttiitnkdeltfekvklinpeyilfphwswii
pkeifenftcvvfhmtdlpfgrggsplqnliergikktkisaikvdggidtgdiffkrdl
dlygtaeeifmraskiifndmipelltkrpvpqkqegeatvfqr

SCOPe Domain Coordinates for d1xg9a3:

Click to download the PDB-style file with coordinates for d1xg9a3.
(The format of our PDB-style files is described here.)

Timeline for d1xg9a3: