SCOPe 2.07: Domain d1xc2a4: 1xc2 A:153-263

Lineage for d1xc2a4 (1xc2 A:153-263)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.10: ProC C-terminal domain-like [116984] (2 proteins)
   similar dimer to the class I KARI

6. Protein Pyrroline-5-carboxylate reductase ProC [116985] (2 species)

7. Species Neisseria meningitidis, serogroup B [TaxId:487] [116986] (3 PDB entries)
   Uniprot Q9K1N1

8. Domain d1xc2a4: 1xc2 A:153-263 [303345]
   Other proteins in same PDB: d1xc2a3
   automated match to d1yqga1
   complexed with pro

Details for d1xc2a4

PDB Entry: 1xc2, 1.9 Å

PDB Description: Crystal Structure of a Pyrroline-5-Carboxylate Reductase from Neisseria meningitides MC58

PDB Compounds: (A:) pyrroline-5-carboxylate reductase

SCOPe Domain Sequences for d1xc2a4:

Sequence; same for both SEQRES and ATOM records:

>d1xc2a4 a.100.1.10 (A:153-263) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]}
deekmhgitgisgsgpayvfylldalqnaairqgfdmaearalslatfkgavalaeqtge
dfeklqknvtskggttheaveafrrhrvaeaisegvcacvrrsqemerqyq

Timeline for d1xc2a4:

• d1xc2a4 first appeared in SCOPe 2.06
  
• d1xc2a4 appears in the current release, SCOPe 2.08