Lineage for d1b4va1 (1b4v A:9-318,A:451-506)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20809Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (7 protein domains)
  6. 20810Protein Cholesterol oxidase [51914] (2 species)
  7. 20814Species Streptomyces sp. [TaxId:1931] [51916] (4 PDB entries)
  8. 20815Domain d1b4va1: 1b4v A:9-318,A:451-506 [30334]
    Other proteins in same PDB: d1b4va2

Details for d1b4va1

PDB Entry: 1b4v (more details), 1.5 Å

PDB Description: cholesterol oxidase from streptomyces

SCOP Domain Sequences for d1b4va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4va1 c.3.1.2 (A:9-318,A:451-506) Cholesterol oxidase {Streptomyces sp.}
gyvpavvigtgygaavsalrlgeagvqtlmlemgqlwnqpgpdgnifcgmlnpdkrsswf
knrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgvgggslvnggmavepkr
syfeeilprvdssemydryfpransmlrvnhidtkwfedtewykfarvsreqagkaglgt
vfvpnvydfgymqreaagevpksalateviygnnhgkqsldktylaaalgtgkvtiqtlh
qvktirqtkdggyaltveqkdtdgkllatkeiscrylflgagslgstellvrardtgtlp
nlnsevgagwXgcvlgkatddygrvagyknlyvtdgslipgsvgvnpfvtitalaernve
riikqdv

SCOP Domain Coordinates for d1b4va1:

Click to download the PDB-style file with coordinates for d1b4va1.
(The format of our PDB-style files is described here.)

Timeline for d1b4va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b4va2