Lineage for d1x6ka_ (1x6k A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564091Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
    unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432
  4. 2564092Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) (S)
  5. 2564093Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)
  6. 2564154Protein Potassium-transporting ATPase B chain, KdpB [111270] (1 species)
    minimal fold of this domain:
  7. 2564155Species Escherichia coli [TaxId:562] [111271] (5 PDB entries)
    Uniprot P03960 316-451
  8. 2564160Domain d1x6ka_: 1x6k A: [303337]
    automated match to d2a29a_
    complexed with anp

Details for d1x6ka_

PDB Entry: 1x6k (more details)

PDB Description: the solution structure of the nucleotide binding domain of kdpb
PDB Compounds: (A:) Potassium-transporting ATPase B chain

SCOPe Domain Sequences for d1x6ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6ka_ d.220.1.1 (A:) Potassium-transporting ATPase B chain, KdpB {Escherichia coli [TaxId: 562]}
nrqasefipaqgvdektladaaqlasladetpegrsivilakqrfnlrerdvqslhatfv
pftaqsrmsginidnrmirkgsvdairrhveangghfptdvdqkvdqvarqgatplvvve
gsrvlgvialkdivkg

SCOPe Domain Coordinates for d1x6ka_:

Click to download the PDB-style file with coordinates for d1x6ka_.
(The format of our PDB-style files is described here.)

Timeline for d1x6ka_: