Lineage for d1x3va1 (1x3v A:8-62)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2054022Protein p67phox [74922] (1 species)
  7. 2054023Species Human (Homo sapiens) [TaxId:9606] [74923] (3 PDB entries)
  8. 2054024Domain d1x3va1: 1x3v A:8-62 [303331]
    Other proteins in same PDB: d1x3va2, d1x3va3
    automated match to d2dmoa_

Details for d1x3va1

PDB Entry: 1x3v (more details)

PDB Description: Solution structure of the 1st SH3 domain from human neutrophil cytosol factor 2 (NCF-2)
PDB Compounds: (A:) neutrophil cytosol factor 2

SCOPe Domain Sequences for d1x3va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x3va1 b.34.2.1 (A:8-62) p67phox {Human (Homo sapiens) [TaxId: 9606]}
eahrvlfgfvpetkeelqvmpgnivfvlkkgndnwatvmfngqkglvpcnylepv

SCOPe Domain Coordinates for d1x3va1:

Click to download the PDB-style file with coordinates for d1x3va1.
(The format of our PDB-style files is described here.)

Timeline for d1x3va1: