Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein p67phox [74922] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [74923] (3 PDB entries) |
Domain d1x3va1: 1x3v A:8-62 [303331] Other proteins in same PDB: d1x3va2, d1x3va3 automated match to d2dmoa_ |
PDB Entry: 1x3v (more details)
SCOPe Domain Sequences for d1x3va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x3va1 b.34.2.1 (A:8-62) p67phox {Human (Homo sapiens) [TaxId: 9606]} eahrvlfgfvpetkeelqvmpgnivfvlkkgndnwatvmfngqkglvpcnylepv
Timeline for d1x3va1: