Lineage for d1wqsc_ (1wqs C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2389935Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2390129Protein Norwalk-like virus processing protease [310746] (2 species)
    Pfam PF05416; 3C-like according to PubMed 16227288
  7. 2390130Species Chiba virus [TaxId:99565] [310999] (1 PDB entry)
  8. 2390133Domain d1wqsc_: 1wqs C: [303324]
    complexed with hg, tar, tla

Details for d1wqsc_

PDB Entry: 1wqs (more details), 2.8 Å

PDB Description: Crystal structure of Norovirus 3C-like protease
PDB Compounds: (C:) 3C-like protease

SCOPe Domain Sequences for d1wqsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wqsc_ b.47.1.4 (C:) Norwalk-like virus processing protease {Chiba virus [TaxId: 99565]}
apptlwsrvvrfgsgwgfwvsptvfittthviptgvreffgepiesiaihrageftqfrf
srkvrpdltgmvleegcpegvvcsilikrdsgellplavrmgaiasmkiqgrlvhgqsgm
lltganakgmdlgtlpgdcgapyvykrnndwvvcgvhaaatksgntvvcavqa

SCOPe Domain Coordinates for d1wqsc_:

Click to download the PDB-style file with coordinates for d1wqsc_.
(The format of our PDB-style files is described here.)

Timeline for d1wqsc_: