Lineage for d3cox_1 (3cox 5-318,451-506)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) 
Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (7 proteins) Protein Cholesterol oxidase [51914] (2 species) 
Species Brevibacterium sterolicum [TaxId:1702] [51915] (2 PDB entries) 
Domain d3cox_1: 3cox 5-318,451-506 [30332]
Other proteins in same PDB: d3cox_2
Details for d3cox_1
PDB Entry: 3cox (more details), 1.8 Å
PDB Description: crystal structure of cholesterol oxidase complexed with a steroid substrate. implications for fad dependent alcohol oxidases
SCOP Domain Sequences for d3cox_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cox_1 c.3.1.2 (5-318,451-506) Cholesterol oxidase {Brevibacterium sterolicum}
tladgdrvpalvigsgyggavaalrltqagiptqivemgrswdtpgsdgkifcgmlnpdk
rsmwladktdqpvsnfmgfginksidryvgvldserfsgikvyqgrgvgggslvnggmav
tpkrnyfeeilpsvdsnemynkyfprantglgvnnidqawfestewykfartgrktaqrs
gfttafvpnvydfeymkkeaagqvtksglggeviygnnagkksldktylaqaaatgklti
ttlhrvtkvapatgsgysvtmeqideqgnvvatkvvtadrvffaagsvgtskllvsmkaq
ghlpnlssqvgegwXgvllnkatdnfgrlpeypglyvvdgslvpgnvgvnpfvtitalae
rnmdkiissdi
SCOP Domain Coordinates for d3cox_1:
Click to download the PDB-style file with coordinates for d3cox_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3cox_1:
- d3cox_1 appears in SCOP 1.57
- d3cox_1 appears in the current release, SCOPe 2.08, called d3coxa1
View in 3D
