SCOPe 2.08: Domain d1wnqa_: 1wnq A:

Lineage for d1wnqa_ (1wnq A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species SARS coronavirus [TaxId:227859] [187411] (13 PDB entries)

8. Domain d1wnqa_: 1wnq A: [303311]
   automated match to d2amda_
   complexed with enb

Details for d1wnqa_

PDB Entry: 1wnq, 2.7 Å

PDB Description: Crystal Structure Of SARS-CoV Mpro in Complex with an Inhibitor I2

PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d1wnqa_:

Sequence; same for both SEQRES and ATOM records:

>d1wnqa_ b.47.1.4 (A:) automated matches {SARS coronavirus [TaxId: 227859]}
frkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirks
nhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngsp
sgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkfy
gpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyepl
tqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqcsg
v

Timeline for d1wnqa_:

• d1wnqa_ first appeared in SCOPe 2.06
  
• d1wnqa_ appears in SCOPe 2.07