Lineage for d1h7xd3 (1h7x D:288-440)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20783Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (3 proteins)
  6. 20791Protein Dihydropyrimidine dehydrogenase, domain 3 [51911] (1 species)
  7. 20792Species Wild boar (Sus scrofa) [51912] (2 PDB entries)
  8. 20800Domain d1h7xd3: 1h7x D:288-440 [30331]
    Other proteins in same PDB: d1h7xa1, d1h7xa2, d1h7xa4, d1h7xa5, d1h7xb1, d1h7xb2, d1h7xb4, d1h7xb5, d1h7xc1, d1h7xc2, d1h7xc4, d1h7xc5, d1h7xd1, d1h7xd2, d1h7xd4, d1h7xd5

Details for d1h7xd3

PDB Entry: 1h7x (more details), 2.01 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex of a mutant enzyme (c671a), nadph and 5-fluorouracil

SCOP Domain Sequences for d1h7xd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7xd3 c.3.1.1 (D:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Wild boar (Sus scrofa)}
pktddifqgltqdqgfytskdflplvaksskagmcachsplpsirgavivlgagdtafdc
atsalrcgarrvflvfrkgfvniravpeevelakeekceflpflsprkvivkggrivavq
fvrteqdetgkwnededqivhlkadvvisafgs

SCOP Domain Coordinates for d1h7xd3:

Click to download the PDB-style file with coordinates for d1h7xd3.
(The format of our PDB-style files is described here.)

Timeline for d1h7xd3: