| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.28: Geminin coiled-coil domain [111469] (2 families) ![]() |
| Family h.1.28.1: Geminin coiled-coil domain [111470] (2 proteins) |
| Protein automated matches [254740] (2 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [311186] (1 PDB entry) |
| Domain d1wlqe_: 1wlq E: [303309] Other proteins in same PDB: d1wlqc_, d1wlqf_ automated match to d2zxxb_ |
PDB Entry: 1wlq (more details), 2.8 Å
SCOPe Domain Sequences for d1wlqe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wlqe_ h.1.28.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqeafdliskenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdl
aevaehvqymaevierls
Timeline for d1wlqe_: