Lineage for d1wlqd_ (1wlq D:)

  1. Root: SCOPe 2.08
  2. Class h: Coiled coil proteins [57942] (7 folds)
  3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. Superfamily h.1.28: Geminin coiled-coil domain [111469] (2 families) (S)
  5. Family h.1.28.1: Geminin coiled-coil domain [111470] (2 proteins)
  6. Protein automated matches [254740] (2 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [311186] (1 PDB entry)
  8. Domain d1wlqd_: 1wlq D: [303308]
    Other proteins in same PDB: d1wlqc_, d1wlqf_
    automated match to d2zxxb_

Details for d1wlqd_

PDB Entry: 1wlq (more details), 2.8 Å

PDB Description: Strucure of Geminin-Cdt1 complex
PDB Compounds: (D:) Geminin

SCOPe Domain Sequences for d1wlqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlqd_ h.1.28.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdlaevaehvqymaevi
erlsn

SCOPe Domain Coordinates for d1wlqd_ are not available.

Timeline for d1wlqd_:

Domains from other chains:
(mouse over for more information)
d1wlqa_, d1wlqb_, d1wlqc_, d1wlqe_, d1wlqf_