SCOPe 2.08: Domain d1wlqc_: 1wlq C:

Lineage for d1wlqc_ (1wlq C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.52: DNA replication factor Cdt1 [109686] (2 proteins)
   automatically mapped to Pfam PF08839

6. Protein automated matches [310847] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [311187] (1 PDB entry)

8. Domain d1wlqc_: 1wlq C: [303307]
   Other proteins in same PDB: d1wlqa_, d1wlqb_, d1wlqd_, d1wlqe_
   automated match to d2zxxc_

Details for d1wlqc_

PDB Entry: 1wlq, 2.8 Å

PDB Description: Strucure of Geminin-Cdt1 complex

PDB Compounds: (C:) CDT1 protein

SCOPe Domain Sequences for d1wlqc_:

Sequence, based on SEQRES records:

>d1wlqc_ a.4.5.52 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kapayqrfhalaqpglpglvlpykyqvlvemfhsmdtivsmlhnrsetvtfakvkqgvqe
mmrkrfeernvgqiktvypmsyrfrqecnvptfkdsikrsdyqltiepllgqeaggatql
tatcllqrrqvfrqnlvervkeqhkvflaslnppmavpddqltrwhprfnvdevpdiepa
elpqppv

Sequence, based on observed residues (ATOM records):

>d1wlqc_ a.4.5.52 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kapayqrfhalaqpglpglvlpykyqvlvemfhsmdtivsmlhnrsetvtfakvkqgvqe
mmrkrfeernvgqiktvypmsyrfrqecnvptfkdsikrsdyqltiepllgqegatqlta
tcllqrrqvfrqnlvervkeqhkvflaslnppmavpddqltrwhprfnvdevpdiepael
pqppv

Timeline for d1wlqc_:

• d1wlqc_ first appeared in SCOPe 2.06
  
• d1wlqc_ appears in SCOPe 2.07