SCOPe 2.08: Domain d1wlqb_: 1wlq B:

Lineage for d1wlqb_ (1wlq B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.28: Geminin coiled-coil domain [111469] (2 families)

5. Family h.1.28.1: Geminin coiled-coil domain [111470] (2 proteins)

6. Protein automated matches [254740] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [311186] (1 PDB entry)

8. Domain d1wlqb_: 1wlq B: [303306]
   Other proteins in same PDB: d1wlqc_, d1wlqf_
   automated match to d2zxxb_

Details for d1wlqb_

PDB Entry: 1wlq, 2.8 Å

PDB Description: Strucure of Geminin-Cdt1 complex

PDB Compounds: (B:) Geminin

SCOPe Domain Sequences for d1wlqb_:

Sequence; same for both SEQRES and ATOM records:

>d1wlqb_ h.1.28.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqeafdliskenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdl
aevaehvqymaevierls

Timeline for d1wlqb_:

• d1wlqb_ first appeared in SCOPe 2.06
  
• d1wlqb_ appears in SCOPe 2.07