Lineage for d1wlqa_ (1wlq A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040591Superfamily h.1.28: Geminin coiled-coil domain [111469] (2 families) (S)
  5. 3040592Family h.1.28.1: Geminin coiled-coil domain [111470] (2 proteins)
  6. 3040604Protein automated matches [254740] (2 species)
    not a true protein
  7. 3040607Species Mouse (Mus musculus) [TaxId:10090] [311186] (1 PDB entry)
  8. 3040608Domain d1wlqa_: 1wlq A: [303305]
    Other proteins in same PDB: d1wlqc_, d1wlqf_
    automated match to d2zxxb_

Details for d1wlqa_

PDB Entry: 1wlq (more details), 2.8 Å

PDB Description: Strucure of Geminin-Cdt1 complex
PDB Compounds: (A:) Geminin

SCOPe Domain Sequences for d1wlqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlqa_ h.1.28.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdlaevaehvqy
maevierlsn

SCOPe Domain Coordinates for d1wlqa_:

Click to download the PDB-style file with coordinates for d1wlqa_.
(The format of our PDB-style files is described here.)

Timeline for d1wlqa_: