![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
![]() | Protein automated matches [190360] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188758] (10 PDB entries) |
![]() | Domain d1wjha1: 1wjh A:8-70 [303300] Other proteins in same PDB: d1wjha2, d1wjha3 automated match to d2ecca_ |
PDB Entry: 1wjh (more details)
SCOPe Domain Sequences for d1wjha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wjha1 a.4.1.1 (A:8-70) automated matches {Human (Homo sapiens) [TaxId: 9606]} krktkeqlailksfflqcqwarredyqkleqitglprpeiiqwfgdtryalkhgqlkwfr dna
Timeline for d1wjha1: