Lineage for d1wjha1 (1wjh A:8-70)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691970Protein automated matches [190360] (3 species)
    not a true protein
  7. 2691983Species Human (Homo sapiens) [TaxId:9606] [188758] (10 PDB entries)
  8. 2691992Domain d1wjha1: 1wjh A:8-70 [303300]
    Other proteins in same PDB: d1wjha2, d1wjha3
    automated match to d2ecca_

Details for d1wjha1

PDB Entry: 1wjh (more details)

PDB Description: Solution Structure of the Homeobox Domain of Human Homeodomain Leucine Zipper-Encoding Gene (Homez)
PDB Compounds: (A:) Homeobox-leucine zipper protein Homez

SCOPe Domain Sequences for d1wjha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjha1 a.4.1.1 (A:8-70) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krktkeqlailksfflqcqwarredyqkleqitglprpeiiqwfgdtryalkhgqlkwfr
dna

SCOPe Domain Coordinates for d1wjha1:

Click to download the PDB-style file with coordinates for d1wjha1.
(The format of our PDB-style files is described here.)

Timeline for d1wjha1: