Lineage for d1h7xc3 (1h7x C:288-440)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) 
Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (3 proteins) 
Protein Dihydropyrimidine dehydrogenase, domain 3 [51911] (1 species) Species Pig (Sus scrofa) [TaxId:9823] [51912] (2 PDB entries) 
Domain d1h7xc3: 1h7x C:288-440 [30330]
Other proteins in same PDB: d1h7xa1, d1h7xa2, d1h7xa4, d1h7xa5, d1h7xb1, d1h7xb2, d1h7xb4, d1h7xb5, d1h7xc1, d1h7xc2, d1h7xc4, d1h7xc5, d1h7xd1, d1h7xd2, d1h7xd4, d1h7xd5
Details for d1h7xc3
PDB Entry: 1h7x (more details), 2.01 Å
PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex of a mutant enzyme (c671a), nadph and 5-fluorouracil
SCOP Domain Sequences for d1h7xc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h7xc3 c.3.1.1 (C:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa)}
pktddifqgltqdqgfytskdflplvaksskagmcachsplpsirgavivlgagdtafdc
atsalrcgarrvflvfrkgfvniravpeevelakeekceflpflsprkvivkggrivavq
fvrteqdetgkwnededqivhlkadvvisafgs
SCOP Domain Coordinates for d1h7xc3:
Click to download the PDB-style file with coordinates for d1h7xc3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h7xc3:
 View in 3DDomains from same chain: (mouse over for more information) d1h7xc1, d1h7xc2, d1h7xc4, d1h7xc5 |
