Lineage for d1wj8c_ (1wj8 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700508Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families) (S)
  5. 2700542Family a.24.16.2: Family 1 bi-partite nucleotidyltransferase subunit [81740] (2 proteins)
    automatically mapped to Pfam PF08780
  6. 2700549Protein Probable nucleotidyltransferase subunit TTHA0048 [116876] (1 species)
  7. 2700550Species Thermus thermophilus [TaxId:274] [116877] (3 PDB entries)
    Uniprot Q5SM95
    Structural genomics target
  8. 2700557Domain d1wj8c_: 1wj8 C: [303298]
    automated match to d1wtya_

Details for d1wj8c_

PDB Entry: 1wj8 (more details), 2.2 Å

PDB Description: Crystal structure of a probable nucleotidyltransferase protein from Thermus Thermophilus HB8
PDB Compounds: (C:) probable nucleotidyltransferase protein

SCOPe Domain Sequences for d1wj8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wj8c_ a.24.16.2 (C:) Probable nucleotidyltransferase subunit TTHA0048 {Thermus thermophilus [TaxId: 274]}
aslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraair
gafqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrlee

SCOPe Domain Coordinates for d1wj8c_:

Click to download the PDB-style file with coordinates for d1wj8c_.
(The format of our PDB-style files is described here.)

Timeline for d1wj8c_: