Lineage for d1wg9b4 (1wg9 B:212-528)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143071Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2143072Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2143073Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (3 protein domains)
  6. 2143124Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68921] (4 species)
  7. 2143139Species Thermus thermophilus [TaxId:274] [82553] (4 PDB entries)
    Uniprot Q7SIC6
  8. 2143144Domain d1wg9b4: 1wg9 B:212-528 [303295]
    Other proteins in same PDB: d1wg9b3
    automated match to d1j3ba1
    complexed with atp, ca, gol, po4

Details for d1wg9b4

PDB Entry: 1wg9 (more details), 2.2 Å

PDB Description: Crystal structure of ATP-dependent phosphoenolpyruvate carboxykinase from Thermus thermophilus HB8
PDB Compounds: (B:) ATP-dependent phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d1wg9b4:

Sequence, based on SEQRES records: (download)

>d1wg9b4 c.91.1.1 (B:212-528) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}
vfpmhasanvgkegdvavffglsgtgkttlstdperpligddehgwsedgvfnfeggcya
kvirlspehepliykasnqfeailenvvvnpesrrvqwdddsktentrssypiahlenvv
esgvaghpraifflsadaygvlppiarlspeeamyyflsgytarvagtergvtepratfs
acfgapflpmhpgvyarmlgekirkhaprvylvntgwtggpygvgyrfplpvtrallkaa
lsgalenvpyrrdpvfgfevpleapgvpqellnpretwadkeaydqqarklarlfqenfq
kyasgvakevaeagprt

Sequence, based on observed residues (ATOM records): (download)

>d1wg9b4 c.91.1.1 (B:212-528) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}
vfpmhasanvgkegdvavffglsgtgkttlstdperpligddehgwsedgvfnfeggcya
kvirlspehepliykasnqfeailenvvvnpesrrvqwdddsktentrssypiahlenvv
esgvaghpraifflsadaygvlppiarlspeeamyyflsgytarvpratfsacfgapflp
mhpgvyarmlgekirkhaprvylvntgwtggpygvgyrfplpvtrallkaalsgalenvp
yrrdpvfgfevpleapgvpqellnpretwadkeaydqqarklarlfqenfqkyasgvake
vaeagprt

SCOPe Domain Coordinates for d1wg9b4:

Click to download the PDB-style file with coordinates for d1wg9b4.
(The format of our PDB-style files is described here.)

Timeline for d1wg9b4:

  • d1wg9b4 is new in SCOPe 2.06-stable