![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
![]() | Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
![]() | Protein automated matches [254425] (17 species) not a true protein |
![]() | Species Methanococcus maripaludis [TaxId:39152] [311185] (2 PDB entries) |
![]() | Domain d1wb2d6: 1wb2 D:272-388 [303292] Other proteins in same PDB: d1wb2a5, d1wb2a6, d1wb2a8, d1wb2a9, d1wb2b4, d1wb2b5, d1wb2c5, d1wb2c6, d1wb2c8, d1wb2c9, d1wb2d4, d1wb2d5 automated match to d4ac9a3 complexed with dxc, so4 |
PDB Entry: 1wb2 (more details), 3.1 Å
SCOPe Domain Sequences for d1wb2d6:
Sequence, based on SEQRES records: (download)
>d1wb2d6 b.44.1.0 (D:272-388) automated matches {Methanococcus maripaludis [TaxId: 39152]} klqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilne visgnecycafeleekvlaevgdrvlitrldlppttlricghglieefkpikdlnik
>d1wb2d6 b.44.1.0 (D:272-388) automated matches {Methanococcus maripaludis [TaxId: 39152]} klqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkeniinecycafele ekvlaevgdrvlitrldlppttlricghglieefkpikdlnik
Timeline for d1wb2d6: