Class b: All beta proteins [48724] (178 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
Protein automated matches [254425] (18 species) not a true protein |
Species Methanococcus maripaludis [TaxId:39152] [311185] (2 PDB entries) |
Domain d1wb1d6: 1wb1 D:272-388 [303276] Other proteins in same PDB: d1wb1a5, d1wb1a6, d1wb1a8, d1wb1a9, d1wb1b4, d1wb1b5, d1wb1c5, d1wb1c6, d1wb1c8, d1wb1c9, d1wb1d4, d1wb1d5 automated match to d4ac9a3 complexed with dxc, gdp, mg, so4 |
PDB Entry: 1wb1 (more details), 3 Å
SCOPe Domain Sequences for d1wb1d6:
Sequence, based on SEQRES records: (download)
>d1wb1d6 b.44.1.0 (D:272-388) automated matches {Methanococcus maripaludis [TaxId: 39152]} klqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilne visgnecycafeleekvlaevgdrvlitrldlppttlricghglieefkpikdlnik
>d1wb1d6 b.44.1.0 (D:272-388) automated matches {Methanococcus maripaludis [TaxId: 39152]} klqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkeniinecycafele ekvlaevgdrvlitrldlppttlricghglieefkpikdlnik
Timeline for d1wb1d6: