Lineage for d1wb1d6 (1wb1 D:272-388)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793865Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2793974Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2793975Protein automated matches [254425] (18 species)
    not a true protein
  7. 2794010Species Methanococcus maripaludis [TaxId:39152] [311185] (2 PDB entries)
  8. 2794014Domain d1wb1d6: 1wb1 D:272-388 [303276]
    Other proteins in same PDB: d1wb1a5, d1wb1a6, d1wb1a8, d1wb1a9, d1wb1b4, d1wb1b5, d1wb1c5, d1wb1c6, d1wb1c8, d1wb1c9, d1wb1d4, d1wb1d5
    automated match to d4ac9a3
    complexed with dxc, gdp, mg, so4

Details for d1wb1d6

PDB Entry: 1wb1 (more details), 3 Å

PDB Description: Crystal structure of translation elongation factor SelB from Methanococcus maripaludis in complex with GDP
PDB Compounds: (D:) translation elongation factor selb

SCOPe Domain Sequences for d1wb1d6:

Sequence, based on SEQRES records: (download)

>d1wb1d6 b.44.1.0 (D:272-388) automated matches {Methanococcus maripaludis [TaxId: 39152]}
klqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilne
visgnecycafeleekvlaevgdrvlitrldlppttlricghglieefkpikdlnik

Sequence, based on observed residues (ATOM records): (download)

>d1wb1d6 b.44.1.0 (D:272-388) automated matches {Methanococcus maripaludis [TaxId: 39152]}
klqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkeniinecycafele
ekvlaevgdrvlitrldlppttlricghglieefkpikdlnik

SCOPe Domain Coordinates for d1wb1d6:

Click to download the PDB-style file with coordinates for d1wb1d6.
(The format of our PDB-style files is described here.)

Timeline for d1wb1d6: