![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
![]() | Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
![]() | Protein automated matches [254425] (18 species) not a true protein |
![]() | Species Methanococcus maripaludis [TaxId:39152] [311185] (2 PDB entries) |
![]() | Domain d1wb1c7: 1wb1 C:272-387 [303271] Other proteins in same PDB: d1wb1a5, d1wb1a6, d1wb1a8, d1wb1a9, d1wb1b4, d1wb1b5, d1wb1c5, d1wb1c6, d1wb1c8, d1wb1c9, d1wb1d4, d1wb1d5 automated match to d4ac9a3 complexed with dxc, gdp, mg, so4 |
PDB Entry: 1wb1 (more details), 3 Å
SCOPe Domain Sequences for d1wb1c7:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wb1c7 b.44.1.0 (C:272-387) automated matches {Methanococcus maripaludis [TaxId: 39152]} klqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilne visgnecycafeleekvlaevgdrvlitrldlppttlricghglieefkpikdlni
Timeline for d1wb1c7:
![]() Domains from same chain: (mouse over for more information) d1wb1c5, d1wb1c6, d1wb1c8, d1wb1c9 |