Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Methanococcus maripaludis [TaxId:39152] [226757] (5 PDB entries) |
Domain d1wb1c5: 1wb1 C:1-179 [303269] Other proteins in same PDB: d1wb1a6, d1wb1a7, d1wb1a8, d1wb1a9, d1wb1b5, d1wb1b6, d1wb1c6, d1wb1c7, d1wb1c8, d1wb1c9, d1wb1d5, d1wb1d6 automated match to d4ac9a4 complexed with dxc, gdp, mg, so4 |
PDB Entry: 1wb1 (more details), 3 Å
SCOPe Domain Sequences for d1wb1c5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wb1c5 c.37.1.0 (C:1-179) automated matches {Methanococcus maripaludis [TaxId: 39152]} mdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyr itlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitk sdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii
Timeline for d1wb1c5:
View in 3D Domains from same chain: (mouse over for more information) d1wb1c6, d1wb1c7, d1wb1c8, d1wb1c9 |