![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
![]() | Protein automated matches [226946] (29 species) not a true protein |
![]() | Species Methanococcus maripaludis [TaxId:39152] [311184] (2 PDB entries) |
![]() | Domain d1wb1a6: 1wb1 A:180-271 [303262] Other proteins in same PDB: d1wb1a5, d1wb1a7, d1wb1a9, d1wb1b4, d1wb1b6, d1wb1c5, d1wb1c7, d1wb1c9, d1wb1d4, d1wb1d6 automated match to d4ac9a1 complexed with dxc, gdp, mg, so4 |
PDB Entry: 1wb1 (more details), 3 Å
SCOPe Domain Sequences for d1wb1a6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wb1a6 b.43.3.0 (A:180-271) automated matches {Methanococcus maripaludis [TaxId: 39152]} rntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesv meakagdrvgmaiqgvdakqiyrgciltskdt
Timeline for d1wb1a6:
![]() Domains from same chain: (mouse over for more information) d1wb1a5, d1wb1a7, d1wb1a8, d1wb1a9 |