SCOPe 2.08: Domain d1wb1a5: 1wb1 A:1-179

Lineage for d1wb1a5 (1wb1 A:1-179)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Methanococcus maripaludis [TaxId:39152] [226757] (5 PDB entries)

8. Domain d1wb1a5: 1wb1 A:1-179 [303261]
   Other proteins in same PDB: d1wb1a6, d1wb1a7, d1wb1a8, d1wb1a9, d1wb1b5, d1wb1b6, d1wb1c6, d1wb1c7, d1wb1c8, d1wb1c9, d1wb1d5, d1wb1d6
   automated match to d4ac9a4
   complexed with dxc, gdp, mg, so4

Details for d1wb1a5

PDB Entry: 1wb1, 3 Å

PDB Description: Crystal structure of translation elongation factor SelB from Methanococcus maripaludis in complex with GDP

PDB Compounds: (A:) translation elongation factor selb

SCOPe Domain Sequences for d1wb1a5:

Sequence, based on SEQRES records:

>d1wb1a5 c.37.1.0 (A:1-179) automated matches {Methanococcus maripaludis [TaxId: 39152]}
mdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyr
itlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitk
sdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii

Sequence, based on observed residues (ATOM records):

>d1wb1a5 c.37.1.0 (A:1-179) automated matches {Methanococcus maripaludis [TaxId: 39152]}
mdfkninlgifghidhgkttlskvlteiagfsafklenyritlvdapghadliravvsaa
diidlalivvdakegpktqtgehmlildhfnipiivvitksdnagteeikrtemimksil
qsthnlknssiipisaktgfgvdelknliittlnnaeii

Timeline for d1wb1a5:

• d1wb1a5 first appeared in SCOPe 2.06
  
• d1wb1a5 appears in SCOPe 2.07