![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
![]() | Protein automated matches [190123] (157 species) not a true protein |
![]() | Species Methanococcus maripaludis [TaxId:39152] [226757] (5 PDB entries) |
![]() | Domain d1wb1a5: 1wb1 A:1-179 [303261] Other proteins in same PDB: d1wb1a6, d1wb1a7, d1wb1a8, d1wb1a9, d1wb1b5, d1wb1b6, d1wb1c6, d1wb1c7, d1wb1c8, d1wb1c9, d1wb1d5, d1wb1d6 automated match to d4ac9a4 complexed with dxc, gdp, mg, so4 |
PDB Entry: 1wb1 (more details), 3 Å
SCOPe Domain Sequences for d1wb1a5:
Sequence, based on SEQRES records: (download)
>d1wb1a5 c.37.1.0 (A:1-179) automated matches {Methanococcus maripaludis [TaxId: 39152]} mdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyr itlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitk sdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii
>d1wb1a5 c.37.1.0 (A:1-179) automated matches {Methanococcus maripaludis [TaxId: 39152]} mdfkninlgifghidhgkttlskvlteiagfsafklenyritlvdapghadliravvsaa diidlalivvdakegpktqtgehmlildhfnipiivvitksdnagteeikrtemimksil qsthnlknssiipisaktgfgvdelknliittlnnaeii
Timeline for d1wb1a5:
![]() Domains from same chain: (mouse over for more information) d1wb1a6, d1wb1a7, d1wb1a8, d1wb1a9 |